PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 219aa    MW: 24910 Da    PI: 8.4523
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031190.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.21.5e-44141391127
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95 
                  lppGfrF+Pt+eelv +yLk+k+ + +l++ +vi+ev+++k++Pw+Lp      e+e yfFs+++ ky++g+r nra +sgyWkatg dk+++s+   
  CCG031190.1  14 LPPGFRFQPTEEELVFQYLKRKILSWPLPA-SVIPEVNVCKYDPWELPGD---MEQERYFFSNKEAKYPNGNRVNRASSSGYWKATGLDKQIVSSswk 107
                  79****************************.99***************54...46799************************************9898 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                  ++++vg+kktLvfy+g+ap+g++tdW    ++
  CCG031190.1 108 NNHVVGMKKTLVFYRGKAPHGSRTDWQNSSFQ 139
                  8899**********************866665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5110151IPR003441NAC domain
PROSITE profilePS5100545.27114168IPR003441NAC domain
PfamPF023651.5E-1915134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
METFNFVRDG MSGLPPGFRF QPTEEELVFQ YLKRKILSWP LPASVIPEVN VCKYDPWELP  60
GDMEQERYFF SNKEAKYPNG NRVNRASSSG YWKATGLDKQ IVSSSWKNNH VVGMKKTLVF  120
YRGKAPHGSR TDWQNSSFQM DKWVVCRIFL KNKGTATTET IETRTNDKVG GTQPILLDFM  180
GRDEIVFDSV SSACSSSSSL AGISSNEQDH EQSSSRNFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-421415217166NAC domain-containing protein 19
4dul_A1e-421415217166NAC domain-containing protein 19
1ut7_B1e-421415217166NO APICAL MERISTEM PROTEIN
1ut7_A1e-421415217166NO APICAL MERISTEM PROTEIN
1ut4_B1e-421415217166NO APICAL MERISTEM PROTEIN
1ut4_A1e-421415217166NO APICAL MERISTEM PROTEIN
3swp_D1e-421415220169NAC domain-containing protein 19
3swp_C1e-421415220169NAC domain-containing protein 19
3swp_B1e-421415220169NAC domain-containing protein 19
3swp_A1e-421415220169NAC domain-containing protein 19
3swm_D1e-421415220169NAC domain-containing protein 19
3swm_C1e-421415220169NAC domain-containing protein 19
3swm_B1e-421415220169NAC domain-containing protein 19
3swm_A1e-421415220169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7700131e-143KP770013.1 Populus tomentosa trans-cinnamate 4-monooxygenase (Potri.015G102100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043026.11e-145PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY934e-73NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB9I3W71e-134B9I3W7_POPTR; Uncharacterized protein
STRINGPOPTR_0012s10530.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-72NAC domain containing protein 83